Specialized Research

Follistatin-315

Also known as: FS-315, FST-315

Molecular Identifiers

Molecular Weight

~35 kDa

Overview

315-amino acid isoform of follistatin with preferential selectivity for myostatin over activin. Considered more specific for muscle growth with less impact on the reproductive and endocrine axes.

Clinical interest in Follistatin-315 centers on preferential myostatin inhibition, with lower activin affinity compared to Follistatin-344. The practical goal is to promote muscle hypertrophy and reduce fibrosis with less interference on the reproductive hormonal axis and FSH levels. Human evidence is scarce and based mostly on preclinical work and small series.

There is no regulatory approval for Follistatin-315 by any agency. It is marketed as a recombinant research protein and, in some markets, dispensed by compounding pharmacies as off-label use in mass-gain protocols, in short subcutaneous cycles of 10–30 days due to its high cost and short half-life. Myostatin inhibitors are prohibited by WADA at all times (in and out of competition).

In direct comparison with Follistatin-344, the 315 isoform is shorter and has a predominantly plasma/systemic profile, with reduced affinity for cell-surface heparan sulfate. In practice this translates into action more focused on myostatin, with less inhibition of activins and less impact on FSH and the reproductive axis than the 344 form — useful when the goal is hypertrophy while preserving gonadal signaling as much as possible. Both forms, however, share regulatory status (no approval) and WADA classification.

Sequence (1 letter): GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW

Protein of 315 amino acids. Shorter isoform of Follistatin-344.

Half-life

~1.5-2 hours

Administration Route

Subcutaneous

Category

Specialized Research

Mechanism of Action

  • Selective myostatin inhibition
  • Lower affinity for activin compared to FS-344
  • Promotion of muscle hypertrophy
  • Less interference with the reproductive hormonal axis

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter Value
Dose 100-200 mcg per injection
Frequency Once daily
Timing Morning or post-workout
Duration 10-30 days

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

  • Injection site redness
  • Fatigue
  • Headache

Product Properties

Purity >97%
Appearance White lyophilized powder
Solubility Soluble in water and bacteriostatic water. Reconstitute gently — do not vortex.
Source Recombinant DNA technology (E. coli or HEK293 cells)
Storage Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 2 weeks. Protect from light and moisture. Avoid repeated freeze-thaw cycles. Aliquot for long-term storage.

Presentations & Preparation

Vials of Follistatin-315 found in the research market:

1 mg

Reconstitution

  • Diluent: Bacteriostatic water
  • Volume: 1 ml per 1 mg vial
  • Inject diluent slowly
  • Gently swirl
  • Immediate use recommended

Storage

  • Lyophilized: Frozen -20°C (long-term)
  • Reconstituted: Refrigerated 2-8°C (up to 7 days)
  • Avoid freeze/thaw cycles
  • Protect from light
Reconstitution Calculator

Scientific Studies

Published studies on Follistatin-315.

Related Peptides