Mazdutide
Molecular Identifiers
Overview
Dual GLP-1/Glucagon agonist. Metabolic research. Gradual dose escalation recommended. Weekly administration.
Approved by NMPA (China) in June 2025 for the treatment of obesity in adults, developed by Innovent Biologics. Dual GLP-1/Glucagon agonist with results of up to 18% weight loss in clinical trials. Global phase 3 trials ongoing.
HSQGTFTSDYSKYLDERAAQDFVQWLLDGGPSSGQPPPS His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Arg-Ala-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Leu-Asp-Gly-Gly-Pro-Ser-Ser-Gly-Gln-Pro-Pro-Pro-Ser (with C20 fatty acid-PEG linker at Lys12) Modified peptide — dual GLP-1/Glucagon agonist with chemical modifications for extended half-life
Half-life
~5-7 days
Administration Route
Subcutaneous
Category
Specialized Research
Mechanism of Action
- GLP-1 receptor agonism (satiety, insulin secretion)
- Glucagon receptor agonism (hepatic lipolysis, thermogenesis)
- Dual effect for weight loss and glycemic control
Dosage Protocol
Data compiled from the literature. This does not constitute medical advice.
| Parameter | Value |
|---|---|
| Dose | 3-6 mg per week (typically) |
| Frequency | Once per week |
| Timing | Same day/time each week |
| Duration | 12-24 weeks |
Reported Side Effects
Adverse effects described in the literature. Severity and frequency vary between individuals.
- Nausea
- Vomiting
- Diarrhea
- Abdominal pain
- Decreased appetite
Product Properties
| Purity | >95% |
| Appearance | White lyophilized powder |
| Solubility | Soluble in water and bacteriostatic water |
| Source | Recombinant DNA technology with post-translational chemical modification (fatty acid-PEG conjugation) |
| Storage | Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 4 weeks. Protect from light and moisture. Avoid repeated freeze-thaw cycles. |
Presentations & Preparation
Vials of Mazdutide found in the research market:
Reconstitution
- Diluent: Bacteriostatic water
- Volume: According to concentration
- Inject the diluent slowly against the vial wall
- Gently swirl until completely dissolved
- Gradual dose escalation recommended
Storage
- Lyophilized: Refrigerated 2-8°C
- Reconstituted: Refrigerated 2-8°C (up to 30 days)
- Protect from direct light
- Do not freeze after reconstitution
Scientific Studies
Published studies on Mazdutide.
Related Peptides
Aviptadil
50-150 mcg per administration (IV or subcutaneous) · 1-3 times daily per protocol
B7-33
100-500 mcg per injection (subcutaneous) · Once daily
Bronchogen
5-10 mg per day via subcutaneous injection · Once daily
Cardiogen
5-10 mg per day subcutaneously · Once daily
Chonluten
5-10 mg per day subcutaneously · Once daily
Crystagen
5-10 mg per day via subcutaneous injection · Once daily