Specialized Research

Mazdutide

Molecular Identifiers

Molecular Formula

C207H317N45O65

CAS Number

2259320-72-0

PubChem CID

167312357

UNII

T091GJL322

Overview

Dual GLP-1/Glucagon agonist. Metabolic research. Gradual dose escalation recommended. Weekly administration.

Approved by NMPA (China) in June 2025 for the treatment of obesity in adults, developed by Innovent Biologics. Dual GLP-1/Glucagon agonist with results of up to 18% weight loss in clinical trials. Global phase 3 trials ongoing.

The main clinical interest in mazdutide is its dual GLP-1/glucagon agonism, which combines the incretin effect of GLP-1 (satiety, insulin secretion, delayed gastric emptying) with glucagon receptor activation (hepatic lipolysis and thermogenesis). This dual profile aims for more pronounced weight loss and glycemic control in patients with obesity and type 2 diabetes.

It received NMPA (China) approval in June 2025 for the treatment of obesity in adults, developed by Innovent Biologics, with up to 18% weight loss in clinical trials. Global phase 3 trials are ongoing and the drug is not yet approved by the FDA, EMA, or ANVISA. Outside China, its use remains restricted to research contexts. Administration is weekly subcutaneous, with gradual dose escalation to mitigate gastrointestinal effects.

Among incretin mimetics, it occupies a peculiar position: as a dual GLP-1/glucagon agonist, it shares the multi-receptor logic of tirzepatide (GLP-1/GIP) and retatrutide (triple), but with approval restricted to China and development led by Innovent. In available trials it outperforms semaglutide alone in weight loss magnitude, but there are no direct global phase 3 comparisons against tirzepatide or retatrutide yet.

Sequence (1 letter): HSQGTFTSDYSKYLDERAAQDFVQWLLDGGPSSGQPPPS
Extended notation: His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys(γGlu-AEEA-AEEA-C20diacid)-Tyr-Leu-Asp-Glu-Arg-Ala-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Leu-Asp-Gly-Gly-Pro-Ser-Ser-Gly-Gln-Pro-Pro-Pro-Ser

Modified peptide — dual GLP-1/Glucagon agonist with chemical modifications for extended half-life

Half-life

~5-7 days

Administration Route

Subcutaneous

Category

Specialized Research

Mechanism of Action

  • GLP-1 receptor agonism (satiety, insulin secretion)
  • Glucagon receptor agonism (hepatic lipolysis, thermogenesis)
  • Dual effect for weight loss and glycemic control

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter Value
Dose 3-6 mg per week (typically)
Frequency Once per week
Timing Same day/time each week
Duration 12-24 weeks

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

  • Nausea
  • Vomiting
  • Diarrhea
  • Abdominal pain
  • Decreased appetite

Product Properties

Purity >95%
Appearance White lyophilized powder
Solubility Soluble in water and bacteriostatic water
Source Recombinant DNA technology with post-translational chemical modification (fatty acid-PEG conjugation)
Storage Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 4 weeks. Protect from light and moisture. Avoid repeated freeze-thaw cycles.

Presentations & Preparation

Vials of Mazdutide found in the research market:

5 mg10 mg

Reconstitution

  • Diluent: Bacteriostatic water
  • Volume: According to concentration
  • Inject the diluent slowly against the vial wall
  • Gently swirl until completely dissolved
  • Gradual dose escalation recommended

Storage

  • Lyophilized: Refrigerated 2-8°C
  • Reconstituted: Refrigerated 2-8°C (up to 30 days)
  • Protect from direct light
  • Do not freeze after reconstitution
Reconstitution Calculator

Scientific Studies

Published studies on Mazdutide.

Related Peptides