Mazdutide
Molecular Identifiers
Overview
Dual GLP-1/Glucagon agonist. Metabolic research. Gradual dose escalation recommended. Weekly administration.
Approved by NMPA (China) in June 2025 for the treatment of obesity in adults, developed by Innovent Biologics. Dual GLP-1/Glucagon agonist with results of up to 18% weight loss in clinical trials. Global phase 3 trials ongoing.
The main clinical interest in mazdutide is its dual GLP-1/glucagon agonism, which combines the incretin effect of GLP-1 (satiety, insulin secretion, delayed gastric emptying) with glucagon receptor activation (hepatic lipolysis and thermogenesis). This dual profile aims for more pronounced weight loss and glycemic control in patients with obesity and type 2 diabetes.
It received NMPA (China) approval in June 2025 for the treatment of obesity in adults, developed by Innovent Biologics, with up to 18% weight loss in clinical trials. Global phase 3 trials are ongoing and the drug is not yet approved by the FDA, EMA, or ANVISA. Outside China, its use remains restricted to research contexts. Administration is weekly subcutaneous, with gradual dose escalation to mitigate gastrointestinal effects.
Among incretin mimetics, it occupies a peculiar position: as a dual GLP-1/glucagon agonist, it shares the multi-receptor logic of tirzepatide (GLP-1/GIP) and retatrutide (triple), but with approval restricted to China and development led by Innovent. In available trials it outperforms semaglutide alone in weight loss magnitude, but there are no direct global phase 3 comparisons against tirzepatide or retatrutide yet.
HSQGTFTSDYSKYLDERAAQDFVQWLLDGGPSSGQPPPS His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys(γGlu-AEEA-AEEA-C20diacid)-Tyr-Leu-Asp-Glu-Arg-Ala-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Leu-Asp-Gly-Gly-Pro-Ser-Ser-Gly-Gln-Pro-Pro-Pro-Ser Modified peptide — dual GLP-1/Glucagon agonist with chemical modifications for extended half-life
Half-life
~5-7 days
Administration Route
Subcutaneous
Category
Specialized Research
Mechanism of Action
- GLP-1 receptor agonism (satiety, insulin secretion)
- Glucagon receptor agonism (hepatic lipolysis, thermogenesis)
- Dual effect for weight loss and glycemic control
Dosage Protocol
Data compiled from the literature. This does not constitute medical advice.
| Parameter | Value |
|---|---|
| Dose | 3-6 mg per week (typically) |
| Frequency | Once per week |
| Timing | Same day/time each week |
| Duration | 12-24 weeks |
Reported Side Effects
Adverse effects described in the literature. Severity and frequency vary between individuals.
- Nausea
- Vomiting
- Diarrhea
- Abdominal pain
- Decreased appetite
Product Properties
| Purity | >95% |
| Appearance | White lyophilized powder |
| Solubility | Soluble in water and bacteriostatic water |
| Source | Recombinant DNA technology with post-translational chemical modification (fatty acid-PEG conjugation) |
| Storage | Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 4 weeks. Protect from light and moisture. Avoid repeated freeze-thaw cycles. |
Presentations & Preparation
Vials of Mazdutide found in the research market:
Reconstitution
- Diluent: Bacteriostatic water
- Volume: According to concentration
- Inject the diluent slowly against the vial wall
- Gently swirl until completely dissolved
- Gradual dose escalation recommended
Storage
- Lyophilized: Refrigerated 2-8°C
- Reconstituted: Refrigerated 2-8°C (up to 30 days)
- Protect from direct light
- Do not freeze after reconstitution
Scientific Studies
Published studies on Mazdutide.
Once-Weekly Mazdutide in Chinese Adults with Obesity or Overweight
Ji L, Jiang H, Bi Y, Li H, Tian J, Liu D, Zhao Y, Qiu W, Huang C, Chen L, Zhong S, Han J, et al.
A phase 2 randomised controlled trial of mazdutide in Chinese overweight adults or adults with obesity
Ji L, Jiang H, An P, Deng H, Liu M, Li L, et al.
Related Peptides
Aviptadil
50-150 mcg per administration (IV or subcutaneous) · 1-3 times daily per protocol
B7-33
Bronchogen
1-2 capsules orally (0.2 g per capsule, containing AKS-B peptide complex) · 1-2 times daily, with meals
Cardiogen
Chonluten
1-2 capsules orally (0.2 g per capsule, containing bronchial tissue peptide complex) · 1-2 times daily, with meals
Crystagen
1-2 capsules orally (0.2 g per capsule, containing AKS-6 peptide complex) · 1-2 times daily, before meals