Specialized Research

Mazdutide

Molecular Identifiers

Molecular Formula

C207H317N45O65

PubChem CID

167312357

Overview

Dual GLP-1/Glucagon agonist. Metabolic research. Gradual dose escalation recommended. Weekly administration.

Approved by NMPA (China) in June 2025 for the treatment of obesity in adults, developed by Innovent Biologics. Dual GLP-1/Glucagon agonist with results of up to 18% weight loss in clinical trials. Global phase 3 trials ongoing.

Sequence (1 letter): HSQGTFTSDYSKYLDERAAQDFVQWLLDGGPSSGQPPPS
Extended notation: His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Arg-Ala-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Leu-Asp-Gly-Gly-Pro-Ser-Ser-Gly-Gln-Pro-Pro-Pro-Ser (with C20 fatty acid-PEG linker at Lys12)

Modified peptide — dual GLP-1/Glucagon agonist with chemical modifications for extended half-life

Half-life

~5-7 days

Administration Route

Subcutaneous

Category

Specialized Research

Mechanism of Action

  • GLP-1 receptor agonism (satiety, insulin secretion)
  • Glucagon receptor agonism (hepatic lipolysis, thermogenesis)
  • Dual effect for weight loss and glycemic control

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter Value
Dose 3-6 mg per week (typically)
Frequency Once per week
Timing Same day/time each week
Duration 12-24 weeks

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

  • Nausea
  • Vomiting
  • Diarrhea
  • Abdominal pain
  • Decreased appetite

Product Properties

Purity >95%
Appearance White lyophilized powder
Solubility Soluble in water and bacteriostatic water
Source Recombinant DNA technology with post-translational chemical modification (fatty acid-PEG conjugation)
Storage Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 4 weeks. Protect from light and moisture. Avoid repeated freeze-thaw cycles.

Presentations & Preparation

Vials of Mazdutide found in the research market:

5 mg10 mg

Reconstitution

  • Diluent: Bacteriostatic water
  • Volume: According to concentration
  • Inject the diluent slowly against the vial wall
  • Gently swirl until completely dissolved
  • Gradual dose escalation recommended

Storage

  • Lyophilized: Refrigerated 2-8°C
  • Reconstituted: Refrigerated 2-8°C (up to 30 days)
  • Protect from direct light
  • Do not freeze after reconstitution
Reconstitution Calculator

Scientific Studies

Published studies on Mazdutide.

Related Peptides