Specialized Research

PNC-27

Also known as: Peptídeo p53

Molecular Identifiers

Molecular Formula

C188H293N53O44S

CAS Number

1159861-00-3

PubChem CID

16201774

Molecular Weight

4031.72 Da

Overview

Research peptide derived from the p53 tumor suppressor protein, designed to selectively bind to HDM-2 protein (human MDM-2) overexpressed on cancer cell membranes. Induces selective lysis of tumor cells without affecting normal cells. Used exclusively in oncology research contexts.

Scientific interest in PNC-27 centers on its mechanism of selective cytotoxicity against tumor cells: it binds to HDM-2 expressed on the membrane of cancer cells and induces lysis via pore formation, in theory sparing normal cells that do not express HDM-2 on the surface. In in vitro and in vivo models it has shown activity against several neoplastic lines.

PNC-27 is strictly a research peptide. It has no approval for clinical use in humans from any regulatory agency and should not be confused with approved oncology therapies. Its use is restricted to laboratories and preclinical studies; any use outside that context lacks support for efficacy or safety in humans.

It was designed from the tumor suppressor p53 activation domain (residues 12-26) fused to a cell-penetrating leader sequence (penetratin). Available data come essentially from preclinical studies; robust human clinical trials are still incipient.

Sequence (1 letter): PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Extended notation: Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly

Hybrid peptide — sequence derived from p53 with HDM-2 binding domain, contains modified amino acids

Half-life

~1-3 hours

Administration Route

Subcutaneous

Category

Specialized Research

Mechanism of Action

  • Selective binding to HDM-2 expressed on cancer cell membranes
  • Induction of selective tumor cell lysis via membrane pore formation
  • Preservation of normal cells that do not express HDM-2 on the surface
  • Activation of apoptotic pathways in neoplastic cells

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

  • Injection site pain
  • Local inflammation
  • Transient fever

Product Properties

Purity >95%
Appearance White lyophilized powder
Solubility Soluble in water and bacteriostatic water
Source Solid-phase peptide synthesis (SPPS)
Storage Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 4 weeks. Protect from light and moisture. Avoid repeated freeze-thaw cycles.

Presentations & Preparation

Vials of PNC-27 found in the research market:

5 mg10 mg15 mg20 mg

Reconstitution

  • Diluent: Bacteriostatic water
  • Volume: 2 ml per vial
  • Inject the diluent slowly against the vial wall
  • Gently swirl until fully dissolved
  • Never shake

Storage

  • Lyophilized: -20°C for long-term storage
  • Reconstituted: Refrigerated 2-8°C (use within a few days)
  • Protect from direct light
  • Do not freeze after reconstitution
  • Maintain strict cold chain
Reconstitution Calculator

Scientific Studies

Published studies on PNC-27.

2010 · Proc Natl Acad Sci U S A

Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes

Sarafraz-Yazdi E, Bowne WB, Adler V, Sookraj KA, Wu V, Shteyler V, Patel H, Oxbury W, Brandt-Rauf P, Zenilman ME, Michl J, Pincus MR

Related Peptides

Aviptadil

50-150 mcg per administration (IV or subcutaneous) · 1-3 times daily per protocol

B7-33

Bronchogen

1-2 capsules orally (0.2 g per capsule, containing AKS-B peptide complex) · 1-2 times daily, with meals

Cardiogen

Chonluten

1-2 capsules orally (0.2 g per capsule, containing bronchial tissue peptide complex) · 1-2 times daily, with meals

Crystagen

1-2 capsules orally (0.2 g per capsule, containing AKS-6 peptide complex) · 1-2 times daily, before meals