Specialized Research

PNC-27

Also known as: Peptídeo p53

Molecular Identifiers

Molecular Formula

C188H293N53O44S

CAS Number

1159861-00-3

Molecular Weight

4031.72 Da

Overview

Research peptide derived from the p53 tumor suppressor protein, designed to selectively bind to HDM-2 protein (human MDM-2) overexpressed on cancer cell membranes. Induces selective lysis of tumor cells without affecting normal cells. Used exclusively in oncology research contexts.

Sequence (1 letter): PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

Extended notation:

Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly

Hybrid peptide — sequence derived from p53 with HDM-2 binding domain, contains modified amino acids

Half-life

~1-3 hours

Administration Route

Subcutaneous

Mechanism of Action

Selective binding to HDM-2 expressed on cancer cell membranes
Induction of selective tumor cell lysis via membrane pore formation
Preservation of normal cells that do not express HDM-2 on the surface
Activation of apoptotic pathways in neoplastic cells

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter	Value
Dose	100-500 mcg per administration (research context)
Frequency	Per research protocol
Timing	Per protocol
Duration	Variable — defined by research protocol

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

Injection site pain
Local inflammation
Transient fever

Product Properties

Purity	>95%
Appearance	White lyophilized powder
Solubility	Soluble in water and bacteriostatic water
Source	Solid-phase peptide synthesis (SPPS)
Storage	Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 4 weeks. Protect from light and moisture. Avoid repeated freeze-thaw cycles.