Metabolic & Fat Loss FDA Phase 3

Cagrilintide

Also known as: NN9838

Molecular Identifiers

Molecular Formula

C194H312N54O59S2

PubChem CID

171397054

Molecular Weight

3948 Da

Overview

Long-acting amylin analog with a molecular weight of approximately 3,948 Da. Developed for obesity treatment, it mimics the effects of endogenous amylin, promoting satiety and delayed gastric emptying with a weekly half-life.

In phase 3 clinical trials for obesity treatment, developed by Novo Nordisk. Studied in combination with semaglutide (CagriSema) with results of up to 22% weight loss in phase 2 studies.

Sequence (1 letter): KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Extended notation: Lys(N-eicosanedioyl-Glu)-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2

Modified peptide — fatty acid-acylated amylin analog for extended half-life

Half-life

~7 days

Administration Route

Subcutaneous

Category

Metabolic & Fat Loss

Mechanism of Action

  • Amylin receptor agonism (AMY1, AMY2, AMY3)
  • Delayed gastric emptying
  • Suppression of postprandial glucagon secretion
  • Promotion of satiety via central signaling in the area postrema
  • Reduction of caloric intake

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter Value
Dose 1.2-4.5 mg per week (subcutaneous)
Frequency Once weekly
Timing Same day and time each week
Duration 16+ weeks (with gradual dose escalation)

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

  • Nausea
  • Diarrhea
  • Vomiting
  • Abdominal pain
  • Constipation
  • Injection site reactions

Product Properties

Purity >98%
Appearance White to off-white lyophilized powder
Solubility Soluble in water and bacteriostatic water
Source Solid-phase peptide synthesis (SPPS) with C20 fatty acid acylation
Storage Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 4 weeks. Protect from light and moisture. Avoid repeated freeze-thaw cycles.

Presentations & Preparation

Vials of Cagrilintide found in the research market:

5 mg10 mg

Reconstitution

  • Diluent: Bacteriostatic water
  • Volume: According to vial concentration
  • Slowly inject the diluent against the vial wall
  • Gently swirl until fully dissolved — never shake
  • Gradual dose escalation recommended for tolerability

Storage

  • Lyophilized: Refrigerated 2-8°C
  • Reconstituted: Refrigerated 2-8°C (up to 30 days)
  • Protect from direct light
  • Do not freeze after reconstitution
Reconstitution Calculator

Scientific Studies

Published studies on Cagrilintide.

Related Peptides