Cagrilintide
Also known as: NN9838
Molecular Identifiers
Overview
Long-acting amylin analog with a molecular weight of approximately 3,948 Da. Developed for obesity treatment, it mimics the effects of endogenous amylin, promoting satiety and delayed gastric emptying with a weekly half-life.
In phase 3 clinical trials for obesity treatment, developed by Novo Nordisk. Studied in combination with semaglutide (CagriSema) with results of up to 22% weight loss in phase 2 studies.
KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Lys(N-eicosanedioyl-Glu)-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 Modified peptide — fatty acid-acylated amylin analog for extended half-life
Half-life
~7 days
Administration Route
Subcutaneous
Category
Metabolic & Fat Loss
Mechanism of Action
- Amylin receptor agonism (AMY1, AMY2, AMY3)
- Delayed gastric emptying
- Suppression of postprandial glucagon secretion
- Promotion of satiety via central signaling in the area postrema
- Reduction of caloric intake
Dosage Protocol
Data compiled from the literature. This does not constitute medical advice.
| Parameter | Value |
|---|---|
| Dose | 1.2-4.5 mg per week (subcutaneous) |
| Frequency | Once weekly |
| Timing | Same day and time each week |
| Duration | 16+ weeks (with gradual dose escalation) |
Reported Side Effects
Adverse effects described in the literature. Severity and frequency vary between individuals.
- Nausea
- Diarrhea
- Vomiting
- Abdominal pain
- Constipation
- Injection site reactions
Product Properties
| Purity | >98% |
| Appearance | White to off-white lyophilized powder |
| Solubility | Soluble in water and bacteriostatic water |
| Source | Solid-phase peptide synthesis (SPPS) with C20 fatty acid acylation |
| Storage | Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 4 weeks. Protect from light and moisture. Avoid repeated freeze-thaw cycles. |
Presentations & Preparation
Vials of Cagrilintide found in the research market:
Reconstitution
- Diluent: Bacteriostatic water
- Volume: According to vial concentration
- Slowly inject the diluent against the vial wall
- Gently swirl until fully dissolved — never shake
- Gradual dose escalation recommended for tolerability
Storage
- Lyophilized: Refrigerated 2-8°C
- Reconstituted: Refrigerated 2-8°C (up to 30 days)
- Protect from direct light
- Do not freeze after reconstitution
Scientific Studies
Published studies on Cagrilintide.
Once-weekly cagrilintide for weight management in people with overweight and obesity: a multicentre, randomised, double-blind, placebo-controlled and active-controlled, dose-finding phase 2 trial
Lau DCW, Erichsen L, Francisco-Ziller N, Johannesen J, Kloverpris S, Krogh P, et al.
Efficacy and safety of co-administered once-weekly cagrilintide 2.4 mg with once-weekly semaglutide 2.4 mg in type 2 diabetes: a multicentre, randomised, double-blind, active-controlled, phase 2 trial
Frias JP, Deenadayalan S, Erichsen L, Knop FK, Lingvay I, Macura S, et al.
Related Peptides
5-Amino-1MQ
50 mg per capsule · 1-2 times daily
Adipotide
0.5-1 mg/kg per injection (subcutaneous) · Once daily
AICAR
50-150 mg per injection · 2-3 times per week
AOD 9604
300-600 mcg per injection · Once daily
Dulaglutide
0.75-4.5 mg per week (subcutaneous) · Once weekly
Exenatide
5-10 mcg per injection (subcutaneous) · Twice daily (Byetta) or once weekly (Bydureon)