Metabolic & Fat Loss FDA Phase 3

Cagrilintide

Also known as: NN9838

Molecular Identifiers

Molecular Formula

C194H312N54O59S2

CAS Number

1415456-99-3

PubChem CID

171397054

UNII

AO43BIF1U8

Molecular Weight

3948 Da

Overview

Long-acting amylin analog with a molecular weight of approximately 3,948 Da. Developed for obesity treatment, it mimics the effects of endogenous amylin, promoting satiety and delayed gastric emptying with a weekly half-life.

In phase 3 clinical trials for obesity treatment, developed by Novo Nordisk. Studied in combination with semaglutide (CagriSema) with results of up to 22% weight loss in phase 2 studies.

Cagrilintide is a long-acting amylin analog whose clinical appeal lies in obesity management. Acting on amylin receptors, it delays gastric emptying, suppresses postprandial glucagon, and promotes central satiety via the area postrema, reducing caloric intake. Acylation with a C20 fatty acid enables a weekly half-life, in line with modern GLP-1 analogs.

The spotlight on Cagrilintide comes from its combination with semaglutide — the protocol known as CagriSema —, which in phase 2 studies showed weight losses superior to those obtained with semaglutide alone. The compound is in phase 3 clinical trials conducted by Novo Nordisk, with no regulatory approval as a medication yet; current access is limited to research contexts and to off-label compounding in some markets, with gradual dose escalation to reduce nausea and gastrointestinal discomfort.

Within the amylin family, it is the long-acting counterpart of pramlintide (a daily amylin analog approved as Symlin), with a weekly dosing schedule compatible with modern analogs. Combined with semaglutide in the CagriSema protocol, it positions itself as an amylin-incretin alternative to multi-receptor strategies like tirzepatide and retatrutide, with a distinct mechanism (amylin + GLP-1) instead of simultaneous agonism of multiple incretin receptors.

Sequence (1 letter): KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Extended notation: Lys(N-eicosanedioyl-Glu)-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2

Modified peptide — fatty acid-acylated amylin analog for extended half-life

Half-life

~7 days

Administration Route

Subcutaneous

Category

Metabolic & Fat Loss

Mechanism of Action

  • Amylin receptor agonism (AMY1, AMY2, AMY3)
  • Delayed gastric emptying
  • Suppression of postprandial glucagon secretion
  • Promotion of satiety via central signaling in the area postrema
  • Reduction of caloric intake

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter Value
Dose 1.2-4.5 mg per week (subcutaneous)
Frequency Once weekly
Timing Same day and time each week
Duration 16+ weeks (with gradual dose escalation)

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

  • Nausea
  • Diarrhea
  • Vomiting
  • Abdominal pain
  • Constipation
  • Injection site reactions

Product Properties

Purity >98%
Appearance White to off-white lyophilized powder
Solubility Soluble in water and bacteriostatic water
Source Solid-phase peptide synthesis (SPPS) with C20 fatty acid acylation
Storage Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 4 weeks. Protect from light and moisture. Avoid repeated freeze-thaw cycles.

Presentations & Preparation

Vials of Cagrilintide found in the research market:

5 mg10 mg

Reconstitution

  • Diluent: Bacteriostatic water
  • Volume: According to vial concentration
  • Slowly inject the diluent against the vial wall
  • Gently swirl until fully dissolved — never shake
  • Gradual dose escalation recommended for tolerability

Storage

  • Lyophilized: Refrigerated 2-8°C
  • Reconstituted: Refrigerated 2-8°C (up to 30 days)
  • Protect from direct light
  • Do not freeze after reconstitution
Reconstitution Calculator

Scientific Studies

Published studies on Cagrilintide.

Related Peptides