Metabolic & Fat Loss FDA Approved

Exenatide

Also known as: Byetta, Bydureon, Exendin-4

Molecular Identifiers

Molecular Formula

C184H282N50O60S

PubChem CID

45588096

Molecular Weight

4186.6 Da

Overview

GLP-1 receptor agonist derived from the saliva of the Gila monster lizard (Heloderma suspectum), composed of 39 amino acids with a molecular weight of approximately 4,186.6 Da. First GLP-1 agonist approved for clinical use, with 53% homology to human GLP-1.

FDA-approved as Byetta (2005) in daily formulation and Bydureon (2012) in weekly extended-release formulation for type 2 diabetes treatment. First GLP-1 agonist approved for clinical use.

Sequence (1 letter): HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Extended notation: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser

Half-life

~2.4 hours

Administration Route

Subcutaneous

Category

Metabolic & Fat Loss

Mechanism of Action

  • GLP-1 receptor agonism (glucose-dependent insulin secretion)
  • Suppression of glucagon secretion in hyperglycemia
  • Delayed gastric emptying
  • Appetite reduction via central signaling
  • Promotion of pancreatic beta cell proliferation and survival

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter Value
Dose 5-10 mcg per injection (subcutaneous)
Frequency Twice daily (Byetta) or once weekly (Bydureon)
Timing 60 minutes before main meals (daily formulation)
Duration Continuous use

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

  • Nausea
  • Vomiting
  • Diarrhea
  • Headache
  • Dizziness
  • Hypoglycemia (with sulfonylureas)

Presentations & Preparation

Vials of Exenatide found in the research market:

5 mg10 mg

Reconstitution

  • Diluent: Bacteriostatic water
  • Volume: According to vial concentration
  • Slowly inject the diluent against the vial wall
  • Gently swirl until fully dissolved — never shake
  • Start with 5 mcg twice daily for 30 days before escalating to 10 mcg

Storage

  • Lyophilized: Refrigerated 2-8°C
  • Reconstituted: Refrigerated 2-8°C (up to 30 days)
  • Protect from direct light
  • Do not freeze after reconstitution
  • Pre-filled pens must be used within 30 days after first use
Reconstitution Calculator

Scientific Studies

Published studies on Exenatide.

Related Peptides