GLP-1(7-37)
Also known as: Peptídeo semelhante ao glucagon 1, GLP-1 nativo
Molecular Identifiers
Molecular Formula
C151H228N40O47
CAS Number
106612-94-6
PubChem CID
16133830Molecular Weight
3355.7 Da
Overview
Native active fragment of glucagon-like peptide-1, composed of 31 amino acids with a molecular weight of approximately 3,355.7 Da. Endogenous incretin hormone produced by L-cells of the small intestine, with an extremely short half-life of 1-2 minutes due to rapid degradation by DPP-4.
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly Half-life
~2 minutes
Administration Route
Subcutaneous or intravenous
Category
Metabolic & Fat Loss
Mechanism of Action
- GLP-1 receptor agonism (glucose-dependent insulin secretion)
- Suppression of glucagon secretion
- Delayed gastric emptying
- Promotion of satiety via hypothalamic signaling
- Trophic effect on pancreatic beta cells
Dosage Protocol
Data compiled from the literature. This does not constitute medical advice.
| Parameter | Value |
|---|---|
| Dose | Variable doses in research context |
| Frequency | Continuous infusion (due to short half-life of 1-2 min) |
| Timing | Per research protocol |
| Duration | Per research protocol |
Reported Side Effects
Adverse effects described in the literature. Severity and frequency vary between individuals.
- Nausea
- Vomiting
- Mild hypoglycemia
Product Properties
| Purity | >98% |
| Appearance | White lyophilized powder |
| Solubility | Soluble in water and bacteriostatic water |
| Source | Solid-phase peptide synthesis (SPPS) or recombinant DNA technology |
| Storage | Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 2 weeks. Protect from light and moisture. Avoid repeated freeze-thaw cycles. |
Presentations & Preparation
Vials of GLP-1(7-37) found in the research market:
Reconstitution
- Diluent: Bacteriostatic water
- Volume: Per vial concentration
- Inject the diluent slowly against the vial wall
- Gently swirl until fully dissolved — never shake
- Prepare immediately before use due to instability
Storage
- Lyophilized: Refrigerated 2-8°C (lyophilized stable for up to 2 years)
- Reconstituted: Refrigerated 2-8°C (use within 24 hours)
- Extremely short half-life — use immediately after reconstitution
- Protect from direct light
- Do not freeze after reconstitution
Related Peptides
5-Amino-1MQ
50 mg per capsule · 1-2 times daily
Adipotide
0.5-1 mg/kg per injection (subcutaneous) · Once daily
AICAR
50-150 mg per injection · 2-3 times per week
AOD 9604
300-600 mcg per injection · Once daily
Cagrilintide
1.2-4.5 mg per week (subcutaneous) · Once weekly
Dulaglutide
0.75-4.5 mg per week (subcutaneous) · Once weekly