Metabolic & Fat Loss

GLP-1(7-37)

Also known as: Peptídeo semelhante ao glucagon 1, GLP-1 nativo

Molecular Identifiers

Molecular Formula

C149H226N40O45

PubChem CID

16133831

Molecular Weight

3355.7 Da

Overview

Native active fragment of glucagon-like peptide-1, composed of 31 amino acids with a molecular weight of approximately 3,355.7 Da. Endogenous incretin hormone produced by L-cells of the small intestine, with an extremely short half-life of 1-2 minutes due to rapid degradation by DPP-4.

Sequence (1 letter): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Extended notation: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly

Half-life

~2 minutes

Administration Route

Subcutaneous or intravenous

Category

Metabolic & Fat Loss

Mechanism of Action

  • GLP-1 receptor agonism (glucose-dependent insulin secretion)
  • Suppression of glucagon secretion
  • Delayed gastric emptying
  • Promotion of satiety via hypothalamic signaling
  • Trophic effect on pancreatic beta cells

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter Value
Dose Variable doses in research context
Frequency Continuous infusion (due to short half-life of 1-2 min)
Timing Per research protocol
Duration Per research protocol

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

  • Nausea
  • Vomiting
  • Mild hypoglycemia

Presentations & Preparation

Vials of GLP-1(7-37) found in the research market:

10 mg

Reconstitution

  • Diluent: Bacteriostatic water
  • Volume: Per vial concentration
  • Inject the diluent slowly against the vial wall
  • Gently swirl until fully dissolved — never shake
  • Prepare immediately before use due to instability

Storage

  • Lyophilized: Refrigerated 2-8°C (lyophilized stable for up to 2 years)
  • Reconstituted: Refrigerated 2-8°C (use within 24 hours)
  • Extremely short half-life — use immediately after reconstitution
  • Protect from direct light
  • Do not freeze after reconstitution
Reconstitution Calculator

Related Peptides