Metabolic & Fat Loss

GLP-1(7-37)

Also known as: Peptídeo semelhante ao glucagon 1, GLP-1 nativo

Molecular Identifiers

Molecular Formula

C151H228N40O47

CAS Number

106612-94-6

PubChem CID

16133830

Molecular Weight

3355.7 Da

Overview

Native active fragment of glucagon-like peptide-1, composed of 31 amino acids with a molecular weight of approximately 3,355.7 Da. Endogenous incretin hormone produced by L-cells of the small intestine, with an extremely short half-life of 1-2 minutes due to rapid degradation by DPP-4.

GLP-1(7-37) is the native active form of the human incretin hormone, responsible for glucose-dependent insulin secretion, glucagon suppression, delayed gastric emptying, satiety induction, and trophic support of pancreatic beta cells. It encompasses the cluster of effects that underpin all derived therapies for type 2 diabetes and obesity.

As a native hormone, its direct clinical use is limited: a half-life of about 1–2 minutes due to rapid DPP-4 degradation precludes conventional protocols, and use is almost exclusively in research, typically as continuous intravenous infusion for physiological studies. There is no directly approved commercial product, and the peptide serves as the pharmacological reference for the design of DPP-4-resistant analogs such as liraglutide, semaglutide, and tirzepatide.

GLP-1 was identified in the 1980s as a post-translational product of the proglucagon gene expressed in intestinal L-cells, opening the path to the incretin class and to modern therapies based on the GLP-1 axis.

Relative to commercial analogs, it is the parent molecule rather than a clinical competitor: semaglutide, dulaglutide, exenatide, and tirzepatide were designed precisely to overcome its practical limitation — a half-life of just minutes due to DPP-4 degradation — via amino acid substitutions, fatty acid acylation, or IgG Fc fusion, while preserving the GLP-1 signaling of the native peptide.

Sequence (1 letter): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Extended notation: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly

Half-life

~2 minutes

Administration Route

Subcutaneous or intravenous

Category

Metabolic & Fat Loss

Mechanism of Action

  • GLP-1 receptor agonism (glucose-dependent insulin secretion)
  • Suppression of glucagon secretion
  • Delayed gastric emptying
  • Promotion of satiety via hypothalamic signaling
  • Trophic effect on pancreatic beta cells

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter Value
Dose 1.0-1.2 pmol/kg/min by intravenous infusion (research use)
Frequency Continuous infusion in a single session
Timing Not established — discrete research sessions
Duration 1-4 hours per session (pharmacological trials)

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

  • Nausea
  • Vomiting
  • Mild hypoglycemia

Product Properties

Purity >98%
Appearance White lyophilized powder
Solubility Soluble in water and bacteriostatic water
Source Solid-phase peptide synthesis (SPPS) or recombinant DNA technology
Storage Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 2 weeks. Protect from light and moisture. Avoid repeated freeze-thaw cycles.

Presentations & Preparation

Vials of GLP-1(7-37) found in the research market:

10 mg

Reconstitution

  • Diluent: Bacteriostatic water
  • Volume: Per vial concentration
  • Inject the diluent slowly against the vial wall
  • Gently swirl until fully dissolved — never shake
  • Prepare immediately before use due to instability

Storage

  • Lyophilized: Refrigerated 2-8°C (lyophilized stable for up to 2 years)
  • Reconstituted: Refrigerated 2-8°C (use within 24 hours)
  • Extremely short half-life — use immediately after reconstitution
  • Protect from direct light
  • Do not freeze after reconstitution
Reconstitution Calculator

Scientific Studies

Published studies on GLP-1(7-37).

1987 · Journal of Clinical Investigation

Insulinotropin: glucagon-like peptide I (7-37) co-encoded in the glucagon gene is a potent stimulator of insulin release in the perfused rat pancreas

Mojsov S, Weir GC, Habener JF

Related Peptides

5-Amino-1MQ

50 mg per capsule · 1-2 times daily

Adipotide

0.03 mg/kg body weight (Phase 1 trial starting dose) · Once daily

AICAR

0.1 mg/kg/min by intravenous infusion (CABG trial dose) · Single continuous infusion

AOD 9604

300-600 mcg per injection · Once daily

Cagrilintide

1.2-4.5 mg per week (subcutaneous) · Once weekly

Dulaglutide

0.75-4.5 mg per week (subcutaneous) · Once weekly