Metabolic & Fat Loss

IGF-1 LR3

Also known as: Long R3 IGF-1, Receptor Grade IGF-1

Molecular Identifiers

Molecular Formula

C400H625N111O115S9

CAS Number

946870-92-4

PubChem CID

168009904

Molecular Weight

~9.1 kDa

Overview

Long-acting analog of insulin-like growth factor type 1 (IGF-1). Modified with Arg→Glu substitution at position 3 and 13-amino acid N-terminal extension, resulting in reduced affinity for IGFBPs and significantly longer half-life.

Sequence (1 letter): MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Extended notation: Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Arg-Arg-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu-Lys-Pro-Ala-Lys-Ser-Ala

Modified IGF-1 analog with 83 amino acids. 13 aa N-terminal extension.

Half-life

~20-30 hours

Administration Route

Subcutaneous or intramuscular

Category

Metabolic & Fat Loss

Mechanism of Action

  • IGF-1R receptor activation with increased affinity
  • Promotion of protein synthesis and muscle hypertrophy
  • Anti-catabolic effect
  • Cell proliferation and differentiation
  • Prolonged half-life due to low affinity for IGFBPs

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter Value
Dose 20-50 mcg per injection
Frequency Once daily (training days)
Timing Immediately post-workout
Duration 4-6 weeks (with equal off intervals)

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

  • Hypoglycemia
  • Joint pain
  • Swelling
  • Headache
  • Numbness in extremities

Product Properties

Purity >95%
Appearance White lyophilized powder
Solubility Soluble in water and bacteriostatic water. Acidic solutions (0.1M acetic acid) recommended for long-term stability.
Source Recombinant DNA technology (E. coli)
Storage Lyophilized: -20°C for up to 2 years, 2-8°C for up to 3 months. Reconstituted: 2-8°C for up to 2 weeks. Keep frozen for long-term storage. Protect from light and moisture. Avoid repeated freeze-thaw cycles.

Presentations & Preparation

Vials of IGF-1 LR3 found in the research market:

100 mcg1 mg

Reconstitution

  • Diluent: Bacteriostatic water or 0.6% acetic acid
  • Volume: 1 ml per 1 mg vial
  • Inject diluent slowly against the vial wall
  • Gently swirl
  • Never shake — sensitive protein

Storage

  • Lyophilized: Frozen -20°C (long-term)
  • Reconstituted: Refrigerated 2-8°C (up to 30 days)
  • Sensitive protein — avoid shaking
  • Protect from light
Reconstitution Calculator

Related Peptides