Metabolic & Fat Loss

IGF-1 LR3

Also known as: Long R3 IGF-1, Receptor Grade IGF-1

Molecular Identifiers

Molecular Formula

C400H625N111O115S9

CAS Number

946870-92-4

PubChem CID

168009904

Molecular Weight

~9.1 kDa

Overview

Long-acting analog of insulin-like growth factor type 1 (IGF-1). Modified with Arg→Glu substitution at position 3 and 13-amino acid N-terminal extension, resulting in reduced affinity for IGFBPs and significantly longer half-life.

The main clinical interest around IGF-1 LR3 lies in its direct anabolic effects on muscle tissue: IGF-1R receptor activation with increased affinity, stimulation of protein synthesis, hyperplasia (myoblast proliferation), and an anti-catabolic effect. Compared to native IGF-1, the significantly longer half-life allows a single daily dose with sustained effect.

IGF-1 LR3 currently has no regulatory approval from any agency (FDA, EMA, ANVISA) for human use, and its use is described almost exclusively in bodybuilding and sports medicine. It is dispensed by compounding pharmacies as off-label use, in short 4-6 week cycles with equal off intervals to avoid receptor desensitization. The risk of hypoglycemia requires glucose monitoring. WADA lists IGF-1 and its analogs as substances prohibited at all times for competitive athletes.

Within the IGF axis, it is often compared with MGF: while IGF-1 LR3 acts systemically via the IGF-1R receptor, with a long half-life and global anabolic stimulus, MGF is an alternative splice product of the same gene, with a localized action focused on muscle satellite cell activation. The two are commonly stacked in sports cycles because their mechanisms are complementary.

Sequence (1 letter): MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Extended notation: Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Arg-Arg-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu-Lys-Pro-Ala-Lys-Ser-Ala

Modified IGF-1 analog with 83 amino acids. 13 aa N-terminal extension.

Half-life

~20-30 hours

Administration Route

Subcutaneous or intramuscular

Category

Metabolic & Fat Loss

Mechanism of Action

  • IGF-1R receptor activation with increased affinity
  • Promotion of protein synthesis and muscle hypertrophy
  • Anti-catabolic effect
  • Cell proliferation and differentiation
  • Prolonged half-life due to low affinity for IGFBPs

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter Value
Dose 20-50 mcg per injection
Frequency Once daily (training days)
Timing Immediately post-workout
Duration 4-6 weeks (with equal off intervals)

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

  • Hypoglycemia
  • Joint pain
  • Swelling
  • Headache
  • Numbness in extremities

Product Properties

Purity >95%
Appearance White lyophilized powder
Solubility Soluble in water and bacteriostatic water. Acidic solutions (0.1M acetic acid) recommended for long-term stability.
Source Recombinant DNA technology (E. coli)
Storage Lyophilized: -20°C for up to 2 years, 2-8°C for up to 3 months. Reconstituted: 2-8°C for up to 2 weeks. Keep frozen for long-term storage. Protect from light and moisture. Avoid repeated freeze-thaw cycles.

Presentations & Preparation

Vials of IGF-1 LR3 found in the research market:

100 mcg1 mg

Reconstitution

  • Diluent: Bacteriostatic water or 0.6% acetic acid
  • Volume: 1 ml per 1 mg vial
  • Inject diluent slowly against the vial wall
  • Gently swirl
  • Never shake — sensitive protein

Storage

  • Lyophilized: Frozen -20°C (long-term)
  • Reconstituted: Refrigerated 2-8°C (up to 30 days)
  • Sensitive protein — avoid shaking
  • Protect from light
Reconstitution Calculator

Scientific Studies

Published studies on IGF-1 LR3.

Related Peptides