IGF-1 LR3
Also known as: Long R3 IGF-1, Receptor Grade IGF-1
Molecular Identifiers
Molecular Formula
C400H625N111O115S9
CAS Number
946870-92-4
PubChem CID
168009904Molecular Weight
~9.1 kDa
Overview
Long-acting analog of insulin-like growth factor type 1 (IGF-1). Modified with Arg→Glu substitution at position 3 and 13-amino acid N-terminal extension, resulting in reduced affinity for IGFBPs and significantly longer half-life.
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Arg-Arg-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu-Lys-Pro-Ala-Lys-Ser-Ala Modified IGF-1 analog with 83 amino acids. 13 aa N-terminal extension.
Half-life
~20-30 hours
Administration Route
Subcutaneous or intramuscular
Category
Metabolic & Fat Loss
Mechanism of Action
- IGF-1R receptor activation with increased affinity
- Promotion of protein synthesis and muscle hypertrophy
- Anti-catabolic effect
- Cell proliferation and differentiation
- Prolonged half-life due to low affinity for IGFBPs
Dosage Protocol
Data compiled from the literature. This does not constitute medical advice.
| Parameter | Value |
|---|---|
| Dose | 20-50 mcg per injection |
| Frequency | Once daily (training days) |
| Timing | Immediately post-workout |
| Duration | 4-6 weeks (with equal off intervals) |
Reported Side Effects
Adverse effects described in the literature. Severity and frequency vary between individuals.
- Hypoglycemia
- Joint pain
- Swelling
- Headache
- Numbness in extremities
Product Properties
| Purity | >95% |
| Appearance | White lyophilized powder |
| Solubility | Soluble in water and bacteriostatic water. Acidic solutions (0.1M acetic acid) recommended for long-term stability. |
| Source | Recombinant DNA technology (E. coli) |
| Storage | Lyophilized: -20°C for up to 2 years, 2-8°C for up to 3 months. Reconstituted: 2-8°C for up to 2 weeks. Keep frozen for long-term storage. Protect from light and moisture. Avoid repeated freeze-thaw cycles. |
Presentations & Preparation
Vials of IGF-1 LR3 found in the research market:
Reconstitution
- Diluent: Bacteriostatic water or 0.6% acetic acid
- Volume: 1 ml per 1 mg vial
- Inject diluent slowly against the vial wall
- Gently swirl
- Never shake — sensitive protein
Storage
- Lyophilized: Frozen -20°C (long-term)
- Reconstituted: Refrigerated 2-8°C (up to 30 days)
- Sensitive protein — avoid shaking
- Protect from light
Related Peptides
5-Amino-1MQ
50 mg per capsule · 1-2 times daily
Adipotide
0.5-1 mg/kg per injection (subcutaneous) · Once daily
AICAR
50-150 mg per injection · 2-3 times per week
AOD 9604
300-600 mcg per injection · Once daily
Cagrilintide
1.2-4.5 mg per week (subcutaneous) · Once weekly
Dulaglutide
0.75-4.5 mg per week (subcutaneous) · Once weekly