Metabolic & Fat Loss FDA Approved

Pramlintide

Also known as: Symlin, Pramlintida, Acetato de Pramlintida

Molecular Identifiers

Molecular Formula

C171H267N51O53S2

PubChem CID

70691388

Molecular Weight

3949.4 Da

Overview

Synthetic analog of human amylin, with a molecular weight of approximately 3,949.4 Da. Amylin is a hormone co-secreted with insulin by pancreatic beta cells. Pramlintide has proline substitutions at positions 25, 28, and 29, providing superior solubility and stability compared to the native peptide. Approved as an adjunct to insulin in the treatment of type 1 and type 2 diabetes.

Approved by the FDA as Symlin (2005) as adjunctive therapy to insulin for patients with type 1 and type 2 diabetes who do not achieve adequate glycemic control with insulin alone.

Sequence (1 letter): KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY
Extended notation: Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr

Half-life

~48 minutes

Administration Route

Subcutaneous

Category

Metabolic & Fat Loss

Mechanism of Action

  • Amylin receptor agonism (AMY1, AMY2, AMY3)
  • Delayed postprandial gastric emptying
  • Suppression of inappropriate postprandial glucagon secretion
  • Promotion of satiety via signaling in the area postrema and nucleus of the solitary tract
  • Reduction of postprandial glycemic excursion
  • Body weight modulation through decreased caloric intake

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter Value
Dose 15-120 mcg per injection (subcutaneous)
Frequency Before main meals (2-3 times daily)
Timing Immediately before meals with 250+ calories
Duration Continuous use (with gradual escalation)

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

  • Nausea
  • Hypoglycemia
  • Anorexia
  • Vomiting
  • Headache
  • Abdominal pain

Presentations & Preparation

Vials of Pramlintide found in the research market:

5 mg10 mg

Reconstitution

  • Diluent: Available as a ready-to-use pen solution
  • Volume: Pre-filled pen of 1.5 ml (1000 mcg/ml)
  • Use pre-filled pen — no reconstitution required
  • Inject subcutaneously in the abdomen or thigh, rotating sites
  • Start with a low dose (15 mcg T1D or 60 mcg T2D) and escalate gradually
  • Reduce prandial insulin dose by 50% when initiating pramlintide

Storage

  • Lyophilized: Not applicable — ready-to-use solution
  • Reconstituted: Refrigerated 2-8°C (unopened); room temperature up to 30 days (in use)
  • Do not freeze
  • Protect from direct light
  • Discard pen after 30 days of use even if not empty
Reconstitution Calculator

Scientific Studies

Published studies on Pramlintide.

Related Peptides