Pramlintide
Also known as: Symlin, Pramlintida, Acetato de Pramlintida
Molecular Identifiers
Overview
Synthetic analog of human amylin, with a molecular weight of approximately 3,949.4 Da. Amylin is a hormone co-secreted with insulin by pancreatic beta cells. Pramlintide has proline substitutions at positions 25, 28, and 29, providing superior solubility and stability compared to the native peptide. Approved as an adjunct to insulin in the treatment of type 1 and type 2 diabetes.
Approved by the FDA as Symlin (2005) as adjunctive therapy to insulin for patients with type 1 and type 2 diabetes who do not achieve adequate glycemic control with insulin alone.
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr Half-life
~48 minutes
Administration Route
Subcutaneous
Category
Metabolic & Fat Loss
Mechanism of Action
- Amylin receptor agonism (AMY1, AMY2, AMY3)
- Delayed postprandial gastric emptying
- Suppression of inappropriate postprandial glucagon secretion
- Promotion of satiety via signaling in the area postrema and nucleus of the solitary tract
- Reduction of postprandial glycemic excursion
- Body weight modulation through decreased caloric intake
Dosage Protocol
Data compiled from the literature. This does not constitute medical advice.
| Parameter | Value |
|---|---|
| Dose | 15-120 mcg per injection (subcutaneous) |
| Frequency | Before main meals (2-3 times daily) |
| Timing | Immediately before meals with 250+ calories |
| Duration | Continuous use (with gradual escalation) |
Reported Side Effects
Adverse effects described in the literature. Severity and frequency vary between individuals.
- Nausea
- Hypoglycemia
- Anorexia
- Vomiting
- Headache
- Abdominal pain
Presentations & Preparation
Vials of Pramlintide found in the research market:
Reconstitution
- Diluent: Available as a ready-to-use pen solution
- Volume: Pre-filled pen of 1.5 ml (1000 mcg/ml)
- Use pre-filled pen — no reconstitution required
- Inject subcutaneously in the abdomen or thigh, rotating sites
- Start with a low dose (15 mcg T1D or 60 mcg T2D) and escalate gradually
- Reduce prandial insulin dose by 50% when initiating pramlintide
Storage
- Lyophilized: Not applicable — ready-to-use solution
- Reconstituted: Refrigerated 2-8°C (unopened); room temperature up to 30 days (in use)
- Do not freeze
- Protect from direct light
- Discard pen after 30 days of use even if not empty
Scientific Studies
Published studies on Pramlintide.
Pramlintide as an Adjunct to Insulin Therapy Improves Long-Term Glycemic and Weight Control in Patients With Type 2 Diabetes
Hollander PA, Levy P, Fineman MS, Maggs DG, Shen LZ, Strobel SA, et al.
Progressive reduction in body weight after treatment with the amylin analog pramlintide in obese subjects: a phase 2, randomized, placebo-controlled, dose-escalation study
Aronne L, Fujioka K, Aroda V, Chen K, Halseth A, Kesty NC, et al.
Related Peptides
5-Amino-1MQ
50 mg per capsule · 1-2 times daily
Adipotide
0.5-1 mg/kg per injection (subcutaneous) · Once daily
AICAR
50-150 mg per injection · 2-3 times per week
AOD 9604
300-600 mcg per injection · Once daily
Cagrilintide
1.2-4.5 mg per week (subcutaneous) · Once weekly
Dulaglutide
0.75-4.5 mg per week (subcutaneous) · Once weekly