Metabolic & Fat Loss FDA Approved

Pramlintide

Also known as: Symlin, Pramlintida, Acetato de Pramlintida

Molecular Identifiers

Molecular Formula

C171H267N51O53S2

CAS Number

151126-32-8

PubChem CID

70691388

Molecular Weight

3949.4 Da

Overview

Synthetic analog of human amylin, with a molecular weight of approximately 3,949.4 Da. Amylin is a hormone co-secreted with insulin by pancreatic beta cells. Pramlintide has proline substitutions at positions 25, 28, and 29, providing superior solubility and stability compared to the native peptide. Approved as an adjunct to insulin in the treatment of type 1 and type 2 diabetes.

Approved by the FDA as Symlin (2005) as adjunctive therapy to insulin for patients with type 1 and type 2 diabetes who do not achieve adequate glycemic control with insulin alone.

Clinical interest in pramlintide centers on postprandial hyperglycemia control in type 1 and type 2 diabetic patients who do not reach glycemic targets on insulin alone. It acts through a mechanism complementary to insulin — delaying gastric emptying, suppressing inappropriate postprandial glucagon, and increasing satiety — leading to reduced glycemic excursion and modest weight loss as an added benefit.

It was FDA-approved in 2005 as Symlin, indicated as adjunctive therapy to prandial insulin. It is prescribed exclusively in an endocrinology setting, in a pre-filled pen, with mandatory escalation (T1D: 15→30→45→60 mcg; T2D: 60→120 mcg) and compulsory 50% reduction of prandial insulin dose at initiation to avoid severe hypoglycemia. It is not mixed with insulin in the same syringe.

Endogenous amylin, from which pramlintide is derived, was identified in pancreatic islet amyloid deposits in type 2 diabetics in the 1980s, which led to the development of a soluble analog with proline substitutions at positions 25, 28, and 29 to overcome the aggregation tendency of the native peptide.

Within the amylin family, it is the short-acting, prandial analog — a counterpoint to cagrilintide (a long-acting amylin with weekly dosing). While pramlintide acts specifically on postprandial glycemic excursion control as an adjunct to insulin, cagrilintide is positioned as a chronic weight management tool, generally combined with semaglutide (CagriSema).

Sequence (1 letter): KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY

Extended notation:

Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr

Half-life

~48 minutes

Administration Route

Subcutaneous

Mechanism of Action

Amylin receptor agonism (AMY1, AMY2, AMY3)
Delayed postprandial gastric emptying
Suppression of inappropriate postprandial glucagon secretion
Promotion of satiety via signaling in the area postrema and nucleus of the solitary tract
Reduction of postprandial glycemic excursion
Body weight modulation through decreased caloric intake

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter	Value
Dose	15-120 mcg per injection (subcutaneous)
Frequency	Before main meals (2-3 times daily)
Timing	Immediately before meals with 250+ calories
Duration	Continuous use (with gradual escalation)

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

Nausea
Hypoglycemia
Anorexia
Vomiting
Headache
Abdominal pain

Product Properties

Purity	>99%
Appearance	White lyophilized powder
Solubility	Soluble in water and bacteriostatic water
Source	Solid-phase peptide synthesis (SPPS)
Storage	Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 30 days. Protect from light and moisture. Avoid repeated freeze-thaw cycles.

Presentations & Preparation

Vials of Pramlintide found in the research market:

5 mg10 mg

Reconstitution

Diluent: Available as a ready-to-use pen solution
Volume: Pre-filled pen of 1.5 ml (1000 mcg/ml)
Use pre-filled pen — no reconstitution required
Inject subcutaneously in the abdomen or thigh, rotating sites
Start with a low dose (15 mcg T1D or 60 mcg T2D) and escalate gradually
Reduce prandial insulin dose by 50% when initiating pramlintide

Storage

Lyophilized: Not applicable — ready-to-use solution
Reconstituted: Refrigerated 2-8°C (unopened); room temperature up to 30 days (in use)
Do not freeze
Protect from direct light
Discard pen after 30 days of use even if not empty

Reconstitution Calculator