Metabolic & Fat Loss FDA Approved

Tirzepatide

Also known as: Mounjaro, Zepbound

Molecular Identifiers

Molecular Formula

C225H348N48O68

CAS Number

2023788-19-2

PubChem CID

168009818

Molecular Weight

4813.45 Da

Overview

Dual GLP-1 and GIP receptor agonist, composed of 39 amino acids with a molecular weight of approximately 4,813.45 Da. Developed for the treatment of type 2 diabetes and obesity, promoting glycemic control and significant weight loss.

Approved by the FDA as Mounjaro (2022) for type 2 diabetes and as Zepbound (2023) for chronic weight management in adults. Dual GIP/GLP-1 agonist with weight loss of up to 22% in clinical trials.

Sequence (1 letter): YXEGTFTSDYSIYLDKIAQKAFVQWLIAGGPSSGAPPPS
Extended notation: Tyr-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-Tyr-Leu-Asp-Lys(γGlu-miniPEG-miniPEG-γGlu-C20diacid)-Ile-Ala-Gln-Lys-Ala-Phe-Val-Gln-Trp-Leu-Ile-Ala-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser

Modified peptide — 39 amino acids with Aib substitution and conjugated C20 diacid fatty acid

Half-life

~5 days

Administration Route

Subcutaneous

Category

Metabolic & Fat Loss

Mechanism of Action

  • GLP-1 receptor agonism (increased glucose-dependent insulin secretion and satiety)
  • GIP receptor agonism (potentiation of the incretin effect and lipid metabolism)
  • Delayed gastric emptying
  • Reduced caloric intake via hypothalamic signaling
  • Improved insulin sensitivity in peripheral tissues

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter Value
Dose 2.5-15 mg per week (subcutaneous)
Frequency Once per week
Timing Same day and time each week, regardless of meals
Duration 12+ weeks (continuous use with gradual escalation)

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

  • Nausea
  • Diarrhea
  • Vomiting
  • Constipation
  • Abdominal pain
  • Decreased appetite

Product Properties

Purity >98%
Appearance White lyophilized powder
Solubility Soluble in water and bacteriostatic water
Source Recombinant DNA technology with chemical modification (fatty acid acylation)
Storage Unused: 2-8°C for up to 2 years. In-use: room temperature (up to 30°C) or 2-8°C for up to 21 days. Do not freeze. Protect from light.

Presentations & Preparation

Vials of Tirzepatide found in the research market:

5 mg10 mg15 mg20 mg30 mg60 mg

Reconstitution

  • Diluent: Bacteriostatic water
  • Volume: 1 ml per vial
  • Inject the diluent slowly against the vial wall
  • Gently swirl until completely dissolved — never shake
  • Dose escalation every 4 weeks (2.5 → 5 → 7.5 → 10 → 12.5 → 15 mg)

Storage

  • Lyophilized: Refrigerated 2-8°C
  • Reconstituted: Refrigerated 2-8°C (up to 30 days)
  • Protect from direct light
  • Do not freeze after reconstitution
  • Pre-filled pens must be refrigerated
Reconstitution Calculator

Scientific Studies

Published studies on Tirzepatide.

Related Peptides