GH Secretagogues FDA Approved

Tesamorelin

Also known as: Egrifta

Molecular Identifiers

Molecular Formula

C221H366N72O67S

CAS Number

218949-48-5

PubChem CID

16137828

Molecular Weight

~5135.9 Da

Overview

GHRH analog focused on visceral fat reduction. Studies demonstrate significant abdominal fat reduction. Sustained GH elevation with daily administration.

FDA-approved as Egrifta (2010) for reduction of excess abdominal fat (lipodystrophy) in HIV patients on antiretroviral therapy.

Tesamorelin is a modified GHRH analog that stimulates pulsatile GH secretion and raises IGF-1 levels. Its most documented clinical effect is the selective reduction of visceral abdominal fat — without equivalent loss of subcutaneous fat — in 12 to 24 week protocols with daily subcutaneous administration. This profile makes it interesting in populations with increased visceral adiposity.

Unlike most GH secretagogues, Tesamorelin has regulatory approval: it was cleared by the FDA in 2010 under the brand name Egrifta, specifically to reduce excess abdominal fat in HIV patients on antiretroviral therapy with lipodystrophy. Outside that indication, it is prescribed off-label for visceral fat management in adults, typically through compounding pharmacies.

Among GHRH analogs, tesamorelin is the only one with regulatory approval and has the most robust clinical evidence for visceral fat, with daily dosing — a profile distinct from sermorelin's native sequence (shorter and discontinued), from Mod GRF 1-29 (CJC-1295 without DAC, multiple daily doses), and from CJC-1295 with DAC (weekly injection, GH plateau). It acts on the GHRH receptor and is therefore also combined with GHRPs (ipamorelin, GHRP-2, GHRP-6, hexarelin) or contrasted with oral MK-677, the long-acting secretagogue on the ghrelin pathway.

Sequence (1 letter): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Extended notation: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu

Half-life

~26-38 minutes

Administration Route

Subcutaneous

Category

GH Secretagogues

Mechanism of Action

  • Modified GHRH analog
  • Potent and sustained stimulation of GH secretion
  • Selective visceral fat reduction
  • IGF-1 elevation

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter Value
Dose 1-2 mg per injection
Frequency Once daily
Timing Morning, fasting
Duration 12-24 weeks

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

  • Injection site reactions
  • Arthralgia
  • Peripheral edema
  • Myalgia
  • Pruritus

Product Properties

Purity >99%
Appearance White lyophilized powder
Solubility Soluble in water and bacteriostatic water
Source Solid-phase peptide synthesis (SPPS)
Storage Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 4 weeks. Protect from light and moisture. Avoid repeated freeze-thaw cycles.

Presentations & Preparation

Vials of Tesamorelin found in the research market:

2 mg5 mg20 mg

Reconstitution

  • Diluent: Bacteriostatic water
  • Volume: 2 ml per 2 mg vial
  • Slowly inject the diluent against the vial wall
  • Gently swirl until fully dissolved
  • Never shake

Storage

  • Lyophilized: Refrigerated 2-8°C
  • Reconstituted: Refrigerated 2-8°C (up to 30 days)
  • Protect from direct light
  • Do not freeze after reconstitution
Reconstitution Calculator

Scientific Studies

Published studies on Tesamorelin.

Related Peptides