Tesamorelin
Also known as: Egrifta
Molecular Identifiers
Molecular Formula
C221H366N72O67S
CAS Number
218949-48-5
PubChem CID
16137828Molecular Weight
~5135.9 Da
Overview
GHRH analog focused on visceral fat reduction. Studies demonstrate significant abdominal fat reduction. Sustained GH elevation with daily administration.
FDA-approved as Egrifta (2010) for reduction of excess abdominal fat (lipodystrophy) in HIV patients on antiretroviral therapy.
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu Half-life
~26-38 minutes
Administration Route
Subcutaneous
Category
GH Secretagogues
Mechanism of Action
- Modified GHRH analog
- Potent and sustained stimulation of GH secretion
- Selective visceral fat reduction
- IGF-1 elevation
Dosage Protocol
Data compiled from the literature. This does not constitute medical advice.
| Parameter | Value |
|---|---|
| Dose | 1-2 mg per injection |
| Frequency | Once daily |
| Timing | Morning, fasting |
| Duration | 12-24 weeks |
Reported Side Effects
Adverse effects described in the literature. Severity and frequency vary between individuals.
- Injection site reactions
- Arthralgia
- Peripheral edema
- Myalgia
- Pruritus
Product Properties
| Purity | >99% |
| Appearance | White lyophilized powder |
| Solubility | Soluble in water and bacteriostatic water |
| Source | Solid-phase peptide synthesis (SPPS) |
| Storage | Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 4 weeks. Protect from light and moisture. Avoid repeated freeze-thaw cycles. |
Presentations & Preparation
Vials of Tesamorelin found in the research market:
Reconstitution
- Diluent: Bacteriostatic water
- Volume: 2 ml per 2 mg vial
- Slowly inject the diluent against the vial wall
- Gently swirl until fully dissolved
- Never shake
Storage
- Lyophilized: Refrigerated 2-8°C
- Reconstituted: Refrigerated 2-8°C (up to 30 days)
- Protect from direct light
- Do not freeze after reconstitution
Scientific Studies
Published studies on Tesamorelin.
Related Peptides
CJC-1295 with DAC
1-2 mg per week · Once per week
CJC-1295 sem DAC
100-200 mcg per injection · 2-3 times daily
GHRP-2
100-300 mcg per injection · 2-3 times per day
GHRP-6
100-300 mcg per injection · 2-3 times per day
Hexarelin
200-300 mcg per injection · 2-3 times per day
Ipamorelin
200-300 mcg per injection · 2-3 times daily