Healing & Recovery

LL-37

Also known as: CAP-18, Catelicidina

Molecular Identifiers

Molecular Formula

C205H340N60O53

CAS Number

597562-32-8

PubChem CID

16198951

Molecular Weight

4493.33 Da

Overview

Human antimicrobial peptide from the cathelicidin family, composed of 37 amino acids. Derived from the hCAP-18 precursor (Human Cationic Antimicrobial Protein), it is naturally produced by neutrophils, macrophages, and epithelial cells. Has a molecular weight of approximately 4,493.33 Da and broad-spectrum antimicrobial activity against bacteria, viruses, fungi, and biofilms.

Sequence (1 letter): [LL-37, 37 aa]
Extended notation: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

Half-life

~4-6 hours

Administration Route

Subcutaneous

Category

Healing & Recovery

Mechanism of Action

  • Broad-spectrum antimicrobial action through disruption of microbial membranes
  • Immunomodulation via recruitment and activation of immune cells
  • Promotion of wound healing and tissue repair
  • Disruption of bacterial biofilms
  • Modulation of inflammatory response via formyl peptide receptors

Dosage Protocol

Data compiled from the literature. This does not constitute medical advice.

Parameter Value
Dose 50-200 mcg per injection
Frequency Once daily
Timing Morning
Duration 2-4 weeks

Reported Side Effects

Adverse effects described in the literature. Severity and frequency vary between individuals.

  • Pain at injection site
  • Redness
  • Local edema
  • Transient fever (rare)

Product Properties

Purity >95%
Appearance White lyophilized powder
Solubility Soluble in water and bacteriostatic water
Source Solid-phase peptide synthesis (SPPS)
Storage Lyophilized: -20°C for up to 2 years, 2-8°C for up to 6 months. Reconstituted: 2-8°C for up to 4 weeks, or -20°C for longer-term storage. Protect from light and moisture. Avoid repeated freeze-thaw cycles.

Presentations & Preparation

Vials of LL-37 found in the research market:

5 mg10 mg15 mg20 mg

Reconstitution

  • Diluent: Bacteriostatic water
  • Volume: 1-2 ml per 5 mg vial
  • Inject the diluent slowly against the vial wall
  • Gently swirl until fully dissolved
  • Never shake

Storage

  • Lyophilized: Refrigerated 2-8°C
  • Reconstituted: Refrigerated 2-8°C (up to 30 days)
  • Protect from direct light
  • Do not freeze after reconstitution
Reconstitution Calculator

Scientific Studies

Published studies on LL-37.

Related Peptides